Antibody data

Product number
H00007746-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007746-M06, RRID:AB_1137544
Product name
ZNF193 monoclonal antibody (M06), clone 3G6
Provider product page
Abnova Corporation - H00007746-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF193.
Antigen sequence
MNTNSKEVLSLGVQVPEAWEELLTMKVEAKSHLQW
QESRLKRSNPLAREIFRRHFRQLCYQETPGPREAL
TRLQELCYQWLRPHVSTKEQ
Isotype
IgG
Antibody clone number
3G6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -