HPA016503

PROZ antibody from Sigma-Aldrich
PZ
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016503
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016503, RRID:AB_10603989
Product name
Anti-PROZ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016503
Antibody type
Polyclonal
Antigen
protein Z, vitamin K-dependent plasma glycoprotein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQH
FCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACG
VLTSEKRAPDLQDLPWQVKLTNSEGKDFCGGVIIR
ENFVLTTAKCSLLHRNITVKTYFNRTSQDPLMIKI
TH
Storage
-20C
Provider Type Product Number
- No reagents -