ABIN487267

HINT1 antibody from antibodies-online
HINT, PKCI-1, PRKCNH1

Antibody data

Product number
ABIN487267
Provider
antibodies-online
Product name
anti-Histidine Triad Nucleotide Binding Protein 1 (HINT1) (N-Term) antibody
Provider product page
antibodies-online - ABIN487267
Antibody type
Polyclonal
Antigen
The immunogen for anti-HINT1 antibody: synthetic peptide directed towards the N terminal of human HINT1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian, Rabbit, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDD
RCLAF HDISPQAPTH
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -