HPA017418

MS4A7 antibody from Sigma-Aldrich
CD20L4, CFFM4, MS4A8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017418
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017418, RRID:AB_1854137
Product name
Anti-MS4A7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017418
Antibody type
Polyclonal
Antigen
Membrane-spanning 4-domains subfamily A member 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLL
ADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYE
IKDCLLTSVSLTGV
Storage
-20C
Provider Type Product Number
- No reagents -