HPA015720

EVA1C antibody from Sigma-Aldrich
B18, B19, C21orf63, C21orf64, FAM176C, PRED34
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015720
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015720, RRID:AB_1845705
Product name
Anti-C21orf63 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015720
Antibody type
Polyclonal
Antigen
Uncharacterized protein C21orf63 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKTVCEDQELKLHCHESKFLNIYSATYGRRTQERD
ICSSKAERLPPFDCLSYSALQVLSRRCYGKQRCKI
IVNNHHFGSPCLPGVKKYLTVTYACVPKNILTAID
PAIANLKPSLKQKDGEYGINFDPSGSKVLRKDGIL
VSNSLA
Storage
-20C
Provider Type Product Number
- No reagents -