HPA015720

EVA1C antibody from Atlas Antibodies
B18, B19, C21orf63, C21orf64, FAM176C, PRED34
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015720
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015720, RRID:AB_1233625
Product name
Anti-EVA1C
Provider product page
Atlas Antibodies - HPA015720
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NKTVCEDQELKLHCHESKFLNIYSATYGRRTQERD
ICSSKAERLPPFDCLSYSALQVLSRRCYGKQRCKI
IVNNHHFGSPCLPGVKKYLTVTYACVPKNILTAID
PAIANLKPSLKQKDGEYGINFDPSGSKVLRKDGIL
VSNSLA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -