HPA007124

ZSCAN31 antibody from Atlas Antibodies
ZNF310P, ZNF323
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007124
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007124, RRID:AB_889118
Product name
Anti-ZSCAN31
Provider product page
Atlas Antibodies - HPA007124
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLLED
VEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQEQ
DGESIPENQELASKQEILKEMEHLGDSKLQRDVSL
DSK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -