HPA007124

ZSCAN31 antibody from Sigma-Aldrich
ZNF310P, ZNF323
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007124
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007124, RRID:AB_1080703
Product name
Anti-ZNF323 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007124
Antibody type
Polyclonal
Antigen
Zinc finger protein 323 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLLED
VEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQEQ
DGESIPENQELASKQEILKEMEHLGDSKLQRDVSL
DSK
Storage
-20C
Provider Type Product Number
- No reagents -