HPA025240

CNPY4 antibody from Atlas Antibodies
MGC40499, PRAT4B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025240
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025240, RRID:AB_2082630
Product name
Anti-CNPY4
Provider product page
Atlas Antibodies - HPA025240
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSR
EVLELGQVLDTGKRKRHVPYSVSETRLEEALENLC
ERI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -