HPA014166

CNPY4 antibody from Sigma-Aldrich
MGC40499, PRAT4B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014166
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014166, RRID:AB_1853895
Product name
Anti-CNPY4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014166
Antibody type
Polyclonal
Antigen
Protein canopy homolog 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWY
FHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEI
TDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHP
KLDRED
Storage
-20C
Provider Type Product Number
- No reagents -