HPA024780

DPY19L4 antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024780
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024780, RRID:AB_10546407
Product name
Anti-DPY19L4
Provider product page
Atlas Antibodies - HPA024780
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ELEREITFQGDSAIYYSYYKDMLKAPSFERGVYEL
THNNKTVSLKTINAVQQMSLYPELIASILYQATG
Isotype
IgG
Vial size (┬Ál)
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -