HPA024780

DPY19L4 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024780
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024780, RRID:AB_10600869
Product name
Anti-DPY19L4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024780
Antibody type
Polyclonal
Antigen
dpy-19-like 4 (C. elegans) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELEREITFQGDSAIYYSYYKDMLKAPSFERGVYEL
THNNKTVSLKTINAVQQMSLYPELIASILYQATG
Storage
-20C
Provider Type Product Number
- No reagents -