HPA029093

TIMM17B antibody from MilliporeSigma / Merck KGaA
DXS9822, JM3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029093
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029093, RRID:AB_10600913
Product name
Anti-TIMM17B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029093
Antibody type
Polyclonal
Antigen
translocase of inner mitochondrial membrane 17 homolog B (yeast) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLP
PKDGTPAPGYPSYQQYH
Storage
-20C
Provider Type Product Number
- No reagents -