HPA023635

ZNF653 antibody from Sigma-Aldrich
Zip67
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023635
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023635, RRID:AB_10603940
Product name
Anti-ZNF653 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023635
Antibody type
Polyclonal
Antigen
zinc finger protein 653 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NVNCLKNVVIWYEDHKHRCPYEPHLAELDPTFGLY
TTAVWQCEAGHRYFQDLHSPLKPLSDSDPDSDKVG
NGLVAGSSDSSSSGS
Storage
-20C
Provider Type Product Number
- No reagents -