HPA024131

APIP antibody from Sigma-Aldrich
APIP2, CGI-29, Mmrp19
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024131
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024131, RRID:AB_10602171
Product name
Anti-APIP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024131
Antibody type
Polyclonal
Antigen
APAF1 interacting protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NTPEEKDLKDRMAHAMNEYPDSCAVLVRRHGVYVW
GETWEKAKTMCECYDYLFDIAVSMKKVGLDPSQLP
VGENGIV
Storage
-20C
Provider Type Product Number
- No reagents -