HPA015721

B4GALNT2 antibody from Sigma-Aldrich
Cad, GALGT2, Sda
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015721
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015721, RRID:AB_1845245
Product name
Anti-B4GALNT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015721
Antibody type
Polyclonal
Antigen
Beta-1,4 N-acetylgalactosaminyltransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGY
NFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPL
PLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGP
DA
Storage
-20C
Provider Type Product Number
- No reagents -