HPA015721

B4GALNT2 antibody from Atlas Antibodies
Cad, GALGT2, Sda
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015721
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015721, RRID:AB_1845245
Product name
Anti-B4GALNT2
Provider product page
Atlas Antibodies - HPA015721
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGY
NFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPL
PLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGP
DA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -