HPA000527

XPNPEP3 antibody from Sigma-Aldrich
APP3, ICP55, NPHPL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000527
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000527, RRID:AB_1079266
Product name
Anti-XPNPEP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000527
Antibody type
Polyclonal
Antigen
Putative Xaa-Pro aminopeptidase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
THPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEA
QGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFL
YLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRD
PSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLL
PKMKAETNMVWYDWMRPSHAQLHSDYMQ
Storage
-20C
Provider Type Product Number
- No reagents -