Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504130 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-RAS-Like, Family 12 (RASL12) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RASL12 antibody: synthetic peptide directed towards the N terminal of human RASL12
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSA
LTVKF LTKRFISEYD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references High-throughput mapping of a dynamic signaling network in mammalian cells.
Barrios-Rodiles M, Brown KR, Ozdamar B, Bose R, Liu Z, Donovan RS, Shinjo F, Liu Y, Dembowy J, Taylor IW, Luga V, Przulj N, Robinson M, Suzuki H, Hayashizaki Y, Jurisica I, Wrana JL
Science (New York, N.Y.) 2005 Mar 11;307(5715):1621-5
Science (New York, N.Y.) 2005 Mar 11;307(5715):1621-5
No comments: Submit comment
No validations: Submit validation data