ABIN501614
antibody from antibodies-online
Targeting: ZBED9
Buster4, FLJ31087, KIAA1925, SCAND3, ZFP38-L, ZNF305P2, ZNF452
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501614 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-SCAN Domain Containing 3 (SCAND3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF452 antibody: synthetic peptide directed towards the n terminal of human ZNF452
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine
- Host
- Rabbit
- Antigen sequence
EAVSRVFPALAGQAPEEQGEIIKVKVKEEDHTWDQ
ESALR RNLSYTRELS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The LIFEdb database in 2006.
Mehrle A, Rosenfelder H, Schupp I, del Val C, Arlt D, Hahne F, Bechtel S, Simpson J, Hofmann O, Hide W, Glatting KH, Huber W, Pepperkok R, Poustka A, Wiemann S
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting