HPA007246

ZBED9 antibody from Atlas Antibodies
Buster4, FLJ31087, KIAA1925, SCAND3, ZFP38-L, ZNF305P2, ZNF452
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007246
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007246, RRID:AB_1080727
Product name
Anti-ZBED9
Provider product page
Atlas Antibodies - HPA007246
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SAFSSEAKLGLSHSQLTEELVASLHTENELDQADK
ELENTLRAQYEENIETGTDSSDIEENLSVTPKVAE
KSPPESRLRFLSCVVCEKECTGVNSCISCDGNIHA
ICGVPSQHGTEGCGRQITCSLCYETSTMK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -