HPA007246

ZBED9 antibody from Sigma-Aldrich
Buster4, FLJ31087, KIAA1925, SCAND3, ZFP38-L, ZNF305P2, ZNF452
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007246
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007246, RRID:AB_1080727
Product name
Anti-SCAND3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007246
Antibody type
Polyclonal
Antigen
Protein ZNF452.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SAFSSEAKLGLSHSQLTEELVASLHTENELDQADK
ELENTLRAQYEENIETGTDSSDIEENLSVTPKVAE
KSPPESRLRFLSCVVCEKECTGVNSCISCDGNIHA
ICGVPSQHGTEGCGRQITCSLCYETSTMK
Storage
-20C
Provider Type Product Number
- No reagents -