Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503610 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Cytohesin 4 (CYTH4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PSCD4 antibody: synthetic peptide directed towards the N terminal of human PSCD4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLV
QALRQ FLWSFRLPGE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references GEP100 links epidermal growth factor receptor signalling to Arf6 activation to induce breast cancer invasion.
Morishige M, Hashimoto S, Ogawa E, Toda Y, Kotani H, Hirose M, Wei S, Hashimoto A, Yamada A, Yano H, Mazaki Y, Kodama H, Nio Y, Manabe T, Wada H, Kobayashi H, Sabe H
Nature cell biology 2008 Jan;10(1):85-92
Nature cell biology 2008 Jan;10(1):85-92
No comments: Submit comment
No validations: Submit validation data