HPA040470

ACSL6 antibody from Atlas Antibodies
ACS2, FACL6, KIAA0837, LACS2, LACS5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA040470
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA040470, RRID:AB_10794033
Product name
Anti-ACSL6
Provider product page
Atlas Antibodies - HPA040470
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RYIINTADISTVIVDKPQKAVLLLEHVERKETPGL
KLIILMDPFEEALKERGQKCGVVIKSMQAVEDCGQ
ENHQAPVPPQPDDLSIVCFTSGTTGNPKGAMLTHG
NVVADF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -