ABIN630435

antibody from antibodies-online

Targeting: CA4 CAIV, Car4, RP17

Western blot

Antibody data

Submit

Validation data

Product number: ABIN630435 - Provider product page
Provider: antibodies-online
Product name: anti-Carbonic Anhydrase IV (CA4) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: Carbonic Anhydrase IV antibody was raised using the middle region of CA4 corresponding to a region with amino acids DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
Description: Purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

CA4 protein structure - ABIN630435 shown in red.