Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310146 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Carbonic Anhydrase IV (CA4) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CA4 antibody: synthetic peptide directed towards the C terminal of human CA4
- Reactivity
- Human, Mouse, Rat, Bovine, Rabbit
- Host
- Rabbit
- Antigen sequence
AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSG
APGRP LPWALPALLG- Vial size
- 50 µg
Submitted references Temporal and parental-specific expression of imprinted genes in a newly derived Chinese human embryonic stem cell line and embryoid bodies.
Mutant carbonic anhydrase 4 impairs pH regulation and causes retinal photoreceptor degeneration.
Sun BW, Yang AC, Feng Y, Sun YJ, Zhu Yf, Zhang Y, Jiang H, Li CL, Gao FR, Zhang ZH, Wang WC, Kong XY, Jin G, Fu SJ, Jin Y
Human molecular genetics 2006 Jan 1;15(1):65-75
Human molecular genetics 2006 Jan 1;15(1):65-75
Mutant carbonic anhydrase 4 impairs pH regulation and causes retinal photoreceptor degeneration.
Yang Z, Alvarez BV, Chakarova C, Jiang L, Karan G, Frederick JM, Zhao Y, Sauvé Y, Li X, Zrenner E, Wissinger B, Hollander AI, Katz B, Baehr W, Cremers FP, Casey JR, Bhattacharya SS, Zhang K
Human molecular genetics 2005 Jan 15;14(2):255-65
Human molecular genetics 2005 Jan 15;14(2):255-65
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Immunohistochemistry