HPA017258

CA4 antibody from Sigma-Aldrich
CAIV, Car4, RP17
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017258
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017258, RRID:AB_1845997
Product name
Anti-CA4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017258
Antibody type
Polyclonal
Antigen
Carbonic anhydrase 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDL
LPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPI
QLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLG
QRTVIKSGA
Storage
-20C
Provider Type Product Number
- No reagents -