Antibody data

Product number
H00002937-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002937-M03, RRID:AB_1575335
Product name
GSS monoclonal antibody (M03), clone 4B6
Provider product page
Abnova Corporation - H00002937-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant GSS.
Antigen sequence
MATNWGSLLQDKQQLEELARQAVDRALAEGVLLRT
SQEPTSSEVVSYAPFTLFPSLVPSALLEQAYAVQM
DFNLLVDAVSQNAAFLEQTLSSTIKQDDFTARLFD
IHKQVLKEGIAQTVFLGLNRSDYMFQRSADGSPAL
KQIEINTISASFGGLASRTPAVHRHVLSVLSKTKE
AGKILSNNPSKGLALGIAKAWELYGSPNALVLLIA
QEKERNIFDQRAIENELLARNIHVIRRTFEDISEK
GSLDQDRRLF
Isotype
IgG
Antibody clone number
4B6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -