Antibody data

Product number
H00113622-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00113622-B01, RRID:AB_1203939
Product name
ADPRHL1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00113622-B01
Antibody type
Polyclonal
Antigen
ADPRHL1 (NP_612439, 1 a.a. ~ 354 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MEKFKAAMLLGSVGDALGYRNVCKENSTVGMKIQE
ELQRSGGLDHLVLSPGEWPVSDNTIMHIATAEALT
TDYWCLDDLYREMVRCYVEIVEKLPERRPDPATIE
GCAQLKPNNYLLAWHTPFNEKGSGFGAATKAMCIG
LRYWKPERLETLIEVSVECGRMTHNHPTGFLGSLC
TALFVSFAAQGKPLVQWGRDMLRAVPLAEEYCRKT
IRHTAEYQEHWFYFEAKWQFYLEERKISKDSENKA
IFPDNYDAEEREKTYRKWSSEGRGGRRGHDAPMIA
YDALLAAGNSWTELCHRAMFHGGESAATGTIAGCL
FGLLYGLDLVPKGLYQDLEDKEKLEDLGAALYRLS
TEEK
Vial size
50 µl
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -