Antibody data

Product number
ABIN405227
Provider
antibodies-online
Product name
anti-Homeobox A5 (HOXA5) antibody
Provider product page
antibodies-online - ABIN405227
Antibody type
Polyclonal
Antigen
The immunogen for anti-HOXA5 antibody: synthetic peptide directed towards the C terminal of human HOXA5
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKW
KKDNK LKSMSMAAAG
Vial size
50 µg
Provider Type Product Number
- No reagents -