HPA024829

PLEKHF2 antibody from Sigma-Aldrich
FLJ13187, PHAFIN2, ZFYVE18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024829
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024829, RRID:AB_10603127
Product name
Anti-PLEKHF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024829
Antibody type
Polyclonal
Antigen
pleckstrin homology domain containing, family F (with FYVE domain) member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLR
NGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTD
LLSKSGKTPSN
Storage
-20C
Provider Type Product Number
- No reagents -