HPA011090

SEMA4C antibody from Atlas Antibodies
Semacl1, Semaf, SEMAI
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011090
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011090, RRID:AB_2185705
Product name
Anti-SEMA4C
Provider product page
Atlas Antibodies - HPA011090
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VDGELYSATLNNFLGTEPIILRNMGPHHSMKTEYL
AFWLNEPHFVGSAYVPESVGSFTGDDDKVYFFFRE
RAVESDCYAEQVVARVARVCKGDMGGARTLQRKWT
TFLKARLACSAPNWQLYF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -