HPA011090

SEMA4C antibody from Sigma-Aldrich
Semacl1, Semaf, SEMAI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011090
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011090, RRID:AB_2185705
Product name
Anti-SEMA4C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011090
Antibody type
Polyclonal
Antigen
Semaphorin-4C precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VDGELYSATLNNFLGTEPIILRNMGPHHSMKTEYL
AFWLNEPHFVGSAYVPESVGSFTGDDDKVYFFFRE
RAVESDCYAEQVVARVARVCKGDMGGARTLQRKWT
TFLKARLACSAPNWQLYF
Storage
-20C
Provider Type Product Number
- No reagents -