Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311004 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Tropomyosin-2 (TPM2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TPM2 antibody: synthetic peptide directed towards the C terminal of human TPM2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKA
ISEEL DNALNDITSL- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Phenotypes of myopathy-related beta-tropomyosin mutants in human and mouse tissue cultures.
Congenital myopathy with nemaline rods and cap structures caused by a mutation in the beta-tropomyosin gene (TPM2).
Abdul-Hussein S, Rahl K, Moslemi AR, Tajsharghi H
PloS one 2013;8(9):e72396
PloS one 2013;8(9):e72396
Congenital myopathy with nemaline rods and cap structures caused by a mutation in the beta-tropomyosin gene (TPM2).
Tajsharghi H, Ohlsson M, Lindberg C, Oldfors A
Archives of neurology 2007 Sep;64(9):1334-8
Archives of neurology 2007 Sep;64(9):1334-8
No comments: Submit comment
No validations: Submit validation data