Antibody data

Product number
H00003903-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003903-M09, RRID:AB_1204606
Product name
LAIR1 monoclonal antibody (M09), clone 3B2
Provider product page
Abnova Corporation - H00003903-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant LAIR1.
Antigen sequence
MSPHPTALLGLVLCLAQTIHTQEEDLPRPSISAEP
GTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYND
TEDVSQASPSESEARFRIDSVSEGNAGPYRCIYYK
PPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGP
TQRPSDNSHNEHAPASQGLKAEHLYILIGVSVVFL
FCLLLLVLFCLHRQNQIKQGPPRSKDEEQKPQQRP
DLAVDVLERTADKATVNGLPEKDRETDTSALAAGS
SQEVTYAQLDHWALTQRTARAVSPQSTKPMAESIT
YAAVARH
Isotype
IgG
Antibody clone number
3B2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -