Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003954-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003954-M03, RRID:AB_534913
- Product name
- LETM1 monoclonal antibody (M03), clone 6F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LETM1.
- Antigen sequence
ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKL
APANGMPTGENVISVAELINAMKQVKHIPESKLTS
LAAALDENKDGKVNIDDLVKVIELVDKEDVHISTS
QVA- Isotype
- IgG
- Antibody clone number
- 6F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references LETM1-dependent mitochondrial Ca2+ flux modulates cellular bioenergetics and proliferation.
Co-delivery of LETM1 and CTMP synergistically inhibits tumor growth in H-ras12V liver cancer model mice.
Regulation of OPA1-mediated mitochondrial fusion by leucine zipper/EF-hand-containing transmembrane protein-1 plays a role in apoptosis.
Association of LETM1 and MRPL36 contributes to the regulation of mitochondrial ATP production and necrotic cell death.
LETM1, deleted in Wolf-Hirschhorn syndrome is required for normal mitochondrial morphology and cellular viability.
Doonan PJ, Chandramoorthy HC, Hoffman NE, Zhang X, Cárdenas C, Shanmughapriya S, Rajan S, Vallem S, Chen X, Foskett JK, Cheung JY, Houser SR, Madesh M
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Nov;28(11):4936-49
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Nov;28(11):4936-49
Co-delivery of LETM1 and CTMP synergistically inhibits tumor growth in H-ras12V liver cancer model mice.
Shin JY, Chung YS, Kang B, Jiang HL, Yu DY, Han K, Chae C, Moon JH, Jang G, Cho MH
Cancer gene therapy 2013 Mar;20(3):186-94
Cancer gene therapy 2013 Mar;20(3):186-94
Regulation of OPA1-mediated mitochondrial fusion by leucine zipper/EF-hand-containing transmembrane protein-1 plays a role in apoptosis.
Piao L, Li Y, Kim SJ, Sohn KC, Yang KJ, Park KA, Byun HS, Won M, Hong J, Hur GM, Seok JH, Shong M, Sack R, Brazil DP, Hemmings BA, Park J
Cellular signalling 2009 May;21(5):767-77
Cellular signalling 2009 May;21(5):767-77
Association of LETM1 and MRPL36 contributes to the regulation of mitochondrial ATP production and necrotic cell death.
Piao L, Li Y, Kim SJ, Byun HS, Huang SM, Hwang SK, Yang KJ, Park KA, Won M, Hong J, Hur GM, Seok JH, Shong M, Cho MH, Brazil DP, Hemmings BA, Park J
Cancer research 2009 Apr 15;69(8):3397-404
Cancer research 2009 Apr 15;69(8):3397-404
LETM1, deleted in Wolf-Hirschhorn syndrome is required for normal mitochondrial morphology and cellular viability.
Dimmer KS, Navoni F, Casarin A, Trevisson E, Endele S, Winterpacht A, Salviati L, Scorrano L
Human molecular genetics 2008 Jan 15;17(2):201-14
Human molecular genetics 2008 Jan 15;17(2):201-14
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of LETM1 expression in transfected 293T cell line by LETM1 monoclonal antibody (M03), clone 6F7.Lane 1: LETM1 transfected lysate(83.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged LETM1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to LETM1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of LETM1 transfected lysate using anti-LETM1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with LETM1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to LETM1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol