HPA011100

LETM1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011100
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011100, RRID:AB_1852802
Product name
Anti-LETM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011100
Antibody type
Polyclonal
Antigen
LETM1 and EF-hand domain-containing protein 1, mitochondrial Precursor (Leucine zipper-EF-hand-containing transmembrane protein 1)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STLGLRNCLNVPFGCCTPIHPVYTSSRGDHLGCWA
LRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWH
SSRPVRDDSVVEKSLKSL
Storage
-20C
Provider Type Product Number
- No reagents -