HPA011101

SPINT2 antibody from Sigma-Aldrich
HAI-2, Kop
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011101
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011101, RRID:AB_1079039
Product name
Anti-SPINT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011101
Antibody type
Polyclonal
Antigen
Kunitz-type protease inhibitor 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCD
GNSNNYLTKEECLKKCATVTENATGDLATSRNAAD
SSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPC
RASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSE
Storage
-20C
Provider Type Product Number
- No reagents -