H00055741-M01
antibody from Abnova Corporation
Targeting: EDEM2
bA4204.1, C20orf31, C20orf49, FLJ10783
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055741-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055741-M01, RRID:AB_509379
- Product name
- C20orf31 monoclonal antibody (M01), clone 2E4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant C20orf31.
- Antigen sequence
PIDPAALHCCQRLKEEQWEVEDLMREFYSLKRCRS
KFQKNTVSSGPWEPPARPGTLFSPENHDQARERKP
AKQKVPLLSCPSQPFTSKLALLGQVFLDSS- Isotype
- IgG
- Antibody clone number
- 2E4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of EDEM2 expression in transfected 293T cell line by C20orf31 monoclonal antibody (M01), clone 2E4.Lane 1: EDEM2 transfected lysate(64.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EDEM2 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of EDEM2 transfected lysate using anti-EDEM2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with EDEM2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to C20orf31 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol