HPA003817

PNMA1 antibody from Atlas Antibodies
MA1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003817
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003817, RRID:AB_611711
Product name
Anti-PNMA1
Provider product page
Atlas Antibodies - HPA003817
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MDVNSQRALLVWGIPVNCDEAEIEETLQAAMPQVS
YRMLGRMFWREENAKAALLELTGAVDYAAIPREMP
GKGGVWKVLFKPPTSDAEFLERLHLFLAREGWTVQ
DVARVLGFQNPTPTPGPEMPAEMLNYILDNVIQPL
VESIWYKRLTL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -