HPA003817

PNMA1 antibody from Sigma-Aldrich
MA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003817
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003817, RRID:AB_1079646
Product name
Anti-PNMA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003817
Antibody type
Polyclonal
Antigen
Paraneoplastic antigen Ma1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MDVNSQRALLVWGIPVNCDEAEIEETLQAAMPQVS
YRMLGRMFWREENAKAALLELTGAVDYAAIPREMP
GKGGVWKVLFKPPTSDAEFLERLHLFLAREGWTVQ
DVARVLGFQNPTPTPGPEMPAEMLNYILDNVIQPL
VESIWYKRLTL
Storage
-20C
Provider Type Product Number
- No reagents -