HPA015007

PNMA1 antibody from Sigma-Aldrich
MA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015007
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015007, RRID:AB_1855502
Product name
Anti-PNMA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015007
Antibody type
Polyclonal
Antigen
Paraneoplastic antigen Ma1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLMESLRGPAADVIRILKSNNPAITTAECLKALEQ
VFGSVESSRDAQIKFLNTYQNPGEKLSAYVIRLEP
LLQKVVEKGAIDKDNVNQARLEQVIAGANHSGAIR
RQLWLTGAGEGPAPNLFQLLVQIREEEAKEEEEEA
EATLLQLGL
Storage
-20C
Provider Type Product Number
- No reagents -