HPA010968

MFF antibody from Atlas Antibodies
C2orf33, GL004

Antibody data

Product number
HPA010968
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010968, RRID:AB_1845714
Product name
Anti-MFF
Provider product page
Atlas Antibodies - HPA010968
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RFQAPISAPEYTVTPSPQQARVCPPHMLPEDGANL
SSARGILSLIQSSTRRAYQQILDVLDENRRPVLRG
GSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVV
DAASLRRQIIKLNRRLQLLEEENKERAKR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.