HPA010968

MFF antibody from Sigma-Aldrich
C2orf33, GL004
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010968
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010968, RRID:AB_1845714
Product name
Anti-MFF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010968
Antibody type
Polyclonal
Antigen
Uncharacterized protein C2orf33 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RFQAPISAPEYTVTPSPQQARVCPPHMLPEDGANL
SSARGILSLIQSSTRRAYQQILDVLDENRRPVLRG
GSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVV
DAASLRRQIIKLNRRLQLLEEENKERAKR
Storage
-20C
Provider Type Product Number
- No reagents -