HPA014343

KLK5 antibody from Sigma-Aldrich
KLK-L2, SCTE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014343
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014343, RRID:AB_1852603
Product name
Anti-KLK5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014343
Antibody type
Polyclonal
Antigen
Kallikrein-5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIIN
GSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLL
TAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKS
IPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINV
SSH
Storage
-20C
Provider Type Product Number
- No reagents -