ABIN486982

CREB3 antibody from antibodies-online
Luman, LZIP, sLZIP

Antibody data

Product number
ABIN486982
Provider
antibodies-online
Product name
anti-CAMP Responsive Element Binding Protein 3 (CREB3) antibody
Provider product page
antibodies-online - ABIN486982
Antibody type
Polyclonal
Antigen
The immunogen for anti-CREB3 antibody: synthetic peptide directed towards the middle region of human CREB3
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine
Host
Rabbit
Antigen sequence
SRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQ
AMVIE ISNKTSSSST
Vial size
50 µg
Provider Type Product Number
- No reagents -