HPA011747

FAM234A antibody from Sigma-Aldrich
C16orf9, DKFZP761D0211, FLJ32603, ITFG3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011747
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011747, RRID:AB_1845585
Product name
Anti-ITFG3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011747
Antibody type
Polyclonal
Antigen
Protein ITFG3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSPCTFAAAVSGANGSTLWERPVAQDVALVECAVP
QPRGSEAPSACILVGRPSSFIAVNLFTGETLWNHS
SSFSGNASILSPLLQVPDVDGDGAPDLLVLTQER
Storage
-20C
Provider Type Product Number
- No reagents -