HPA051150

ALDH3A1 antibody from Atlas Antibodies
ALDH3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA051150
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA051150, RRID:AB_2681364
Product name
Anti-ALDH3A1
Provider product page
Atlas Antibodies - HPA051150
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NSGMGSYHGKKSFETFSHRRSCLVRPLMNDEGLKV
RYPPSPAKMTQH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -