Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309985 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-JAZF Zinc Finger 1 (JAZF1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-JAZF1 antibody: synthetic peptide directed towards the C terminal of human JAZF1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
KKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKS
YKTAQ GLRHHTINFH- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Variation in KLK genes, prostate-specific antigen and risk of prostate cancer.
Multiple loci identified in a genome-wide association study of prostate cancer.
Ahn J, Berndt SI, Wacholder S, Kraft P, Kibel AS, Yeager M, Albanes D, Giovannucci E, Stampfer MJ, Virtamo J, Thun MJ, Feigelson HS, Cancel-Tassin G, Cussenot O, Thomas G, Hunter DJ, Fraumeni JF Jr, Hoover RN, Chanock SJ, Hayes RB
Nature genetics 2008 Sep;40(9):1032-4; author reply 1035-6
Nature genetics 2008 Sep;40(9):1032-4; author reply 1035-6
Multiple loci identified in a genome-wide association study of prostate cancer.
Thomas G, Jacobs KB, Yeager M, Kraft P, Wacholder S, Orr N, Yu K, Chatterjee N, Welch R, Hutchinson A, Crenshaw A, Cancel-Tassin G, Staats BJ, Wang Z, Gonzalez-Bosquet J, Fang J, Deng X, Berndt SI, Calle EE, Feigelson HS, Thun MJ, Rodriguez C, Albanes D, Virtamo J, Weinstein S, Schumacher FR, Giovannucci E, Willett WC, Cussenot O, Valeri A, Andriole GL, Crawford ED, Tucker M, Gerhard DS, Fraumeni JF Jr, Hoover R, Hayes RB, Hunter DJ, Chanock SJ
Nature genetics 2008 Mar;40(3):310-5
Nature genetics 2008 Mar;40(3):310-5
No comments: Submit comment
No validations: Submit validation data