HPA003593

VIPAS39 antibody from Sigma-Aldrich
C14orf133, hSPE-39, SPE-39, SPE39, VIPAR, VPS16B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003593
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003593, RRID:AB_10601879
Product name
Anti-C14orf133 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003593
Antibody type
Polyclonal
Antigen
Uncharacterized protein C14orf133 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AHIQDHYTLLERQIIIEANDRHLESAGQTEIFRKH
PRKASILNMPLVTTLFYSCFYHYTEAEGTFSSPVN
LKKTFKIPDKQYVLTALAARAKLRAWNDVDALFTT
KNWLGYTKKRAPIGFHRVVEILHKNNAPVQILQEY
VNLVEDVDTK
Storage
-20C
Provider Type Product Number
- No reagents -